PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000234846
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 747aa    MW: 84357 Da    PI: 9.2049
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000234846genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.67.6e-10235280146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r++WT+ Ed+ l+  v++ G ++W  Ia  +g++Rt+ qc  r+q 
    MDP0000234846 235 RKSWTAKEDKNLLYFVQEKGINNWFDIAVSLGTNRTPFQCLARYQR 280
                      789*****************************************96 PP

2Myb_DNA-binding36.31.3e-11289326240
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40 
                        WT++Ed +l  av+ lG g+W +Ia+ +g gR + qc
    MDP0000234846 289 REWTKDEDARLRSAVETLGEGNWQAIASALG-GRAGTQC 326
                      68*****************************.******* PP

3Myb_DNA-binding35.72.1e-11360399243
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 
                      g W +eEd +l  a++++G   W+++a++++ +Rt+++c  r
    MDP0000234846 360 GEWAEEEDSRLRAAIEEHGYC-WSKVAACVP-RRTDNMCWRR 399
                      68*****************99.*********.*******666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.9E-4134231IPR001005SANT/Myb domain
PROSITE profilePS500905.97135229IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.4E-11137153IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-11202242IPR009057Homeodomain-like
SuperFamilySSF466892.02E-16211279IPR009057Homeodomain-like
PROSITE profilePS500909.466230282IPR017877Myb-like domain
SMARTSM007171.9E-9234284IPR001005SANT/Myb domain
CDDcd001673.31E-7237282No hitNo description
PfamPF139212.0E-12238299No hitNo description
Gene3DG3DSA:1.10.10.607.9E-13243293IPR009057Homeodomain-like
PROSITE profilePS5129414.017283335IPR017930Myb domain
SuperFamilySSF466891.8E-16286399IPR009057Homeodomain-like
SMARTSM007172.3E-6287336IPR001005SANT/Myb domain
CDDcd001674.75E-8290326No hitNo description
Gene3DG3DSA:1.10.10.608.9E-13294358IPR009057Homeodomain-like
PROSITE profilePS5129417.056354408IPR017930Myb domain
SMARTSM007173.0E-9358406IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-14359399IPR009057Homeodomain-like
PfamPF002491.1E-9360399IPR001005SANT/Myb domain
CDDcd001677.80E-8361403No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MIRNRFPDPE DADLATXPLS DNAEGQSSAL IVWNQSDSCS TSMLPRKDSS FPKAAQVFMD  60
AIKKNRASQK FIRNKLIQIE AKIEENRKXK ERVKILKDFQ VHYKKISALL YGPEENSHVA  120
NYRMTMKKYL DSLCRKKWSK VEKEALEKGI KQQFQEMVLQ SSVDESSFSE RPCGESNHID  180
DILASIKGLE ITPEIIREFL PKVKWEQLAS MYLPGRSGAE CETRWLNWED PLINRKSWTA  240
KEDKNLLYFV QEKGINNWFD IAVSLGTNRT PFQCLARYQR SLNASILKRE WTKDEDARLR  300
SAVETLGEGN WQAIASALGG RAGTQCSNSI FHTSQMEEIS SPNQEKRRYV NSLEPSLNYG  360
EWAEEEDSRL RAAIEEHGYC WSKVAACVPR RTDNMCWRRC KVLYPEEVLL LKEQKKIKKV  420
ALMCNFVDRE EERPALGPND FLPPIDTSTK TLTYPKKQNG KLSKVPNKTR SXRNKNNSES  480
CSDAHGIDNS DQVETSNGHD APNKKNNVRK QRRRRRKSTE PTGEGQVIVP VPDEHVTHKE  540
EQRETSCSDQ IVGTSDGDDT TLAVFQRNKS KKRNLGPPSN DTRKKRKLVV SDCSVQDSPT  600
NNIQKGAGSH PEAAIMVCDS EQGGLKLDSE RNVTFQEPVI TVAGVSPKSD HDADDVLASL  660
GKKKSKKKRP QTSKSRPQTS KSRPSSXTMK SESLPKGVGL GKGEGLDHCE PVSETGSNGA  720
EGDHEDGDMT LACFLRNKSK KRRRQCG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-222053944149MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-222053944149MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1508516RKQRRRRRK
2570586KKRNLGPPSNDTRKKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.14821e-68fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008393534.10.0PREDICTED: snRNA-activating protein complex subunit 4-like
TrEMBLM5WEG40.0M5WEG4_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s04260.11e-164(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-131myb domain protein 4r1